teri jane

botbucherongratuitdofusfinaldjvu

term 1 year 9 ist task 1 pdf

teri_meherbaniyanhussam_walhan_rar

term1219

teri_meri_bodyguard__video_song__feat_salman_khan__funb4ucom3gp8b75b3gp

terez montcalm flac full free

term3 ada3m portfolio assignments doc

SUN OF RIGHTEOUSNESS (3)

108,864 – 954 – 792 – 756 – 216 – 144 – 114,048

Section IV, Part 10 –

teri_hatcher_nude_scene

termpakenclosuredesignsoftwareserialiso

termenlijst pozieanalyse 5h en 6v doc

teri_deewani_kailash_khermkv

terez montcalm torrents full discography

terkatung katung dian marsanda mp4 4

diamondrushparapctaringazip

tereza2_porno_fuck_xxx_kurva_pisa_teen_anal_

graphic desiign The Wonderful Numbers of Sacred Canon

by Doug Krieger

 

 
 
 

New Gideon's Chronicle's Post

termelesi logisztika pdf

teri_weigel_untamed_scene_with_mavi

teri_meri_surround_sound_mix__dj_gsharanmp3

teri meri video songs with lyrics

teri_weigel_s_beach_bash_cd2avi

tereza_brettschweiderova_kristynavi

teri_meri_video_song_wwwaforyounet

January 1
Gideon's
Chronicles
converted to a Flip-Book

Day 32 - Latest entry

TribNet Partners

Some of our recent articles...

Sun of Righteousness (3)
Section IV, Part 10 – The Wonderful Numbers of Sacred Canon

The Good News

Sun of Righteousness (2)
Section IV, Part 9 – The Wonderful Numbers of Sacred Canon

teri meri dance mixmp3

terihatchertango_cashnipslipbluray720p

terjemah_kitab_matan_al_ajrumiyah_2pdf

terirem

teri meri bodyguard full hd video song ft salman kareena rahat shreya lyrics 2011 y

tereza_sensual_oil_massage

teri yaad yaad bewafaa dj pkv rocks

Beauty and the Beast
…the Beast State is
Turning on the Church

 

Sun of Righteousness (1)
Section IV, Part 8 – The Wonderful Numbers of Sacred Canon

Israel's Alters

Altars – Ancient Egypt to the Apocalypse
Part IV, Section 4 – The Wonderful Numbers of Sacred Canon

None Dare Call it Conspiracy - Rethinking our Lives

 

teri woods

terlin lemmancheuravi

term sheets and valuations by alex wilmerding

terios_fanclub_38480234503600922770_26032229711239939764278612356922899partrar

teri meri prem kahani haseenaavi

teri_meri_body_guard_mix_2011_dj_irfan_9819619973

teri bahon mein

cricket coach 2008  
 

terkantoi__dipaksa_lakukan_seks

teri_weigel__my_mom_the_milf

hans a plast

terioplot 1 0 pdf

teri meri video songs

teri meri prem kahani bodyguard 2011 full video song hd ft rahat fateh ali khanflv youtubeflv

teri_meri_flute_highmp3 mobile9mp3

termico italsoft full free

terez_montcalm_torrents_full_discography2010zip

terez montcalm torrents full discographytorrent

teri_oremkv

teri deewani 12 kehnde ne naina

terex_fuchspdf

terez montcalm connection 2009

teri meri video songs with songs

This three-fold sequence on The Sun of Righteousness is a frontal assault upon the metrological indiscretions of the Sacred Geometry Community which, unfortunately for whatever reason – be it purposeful or through darkened neglect – have marginalized, even obfuscated, the Sun of Righteousness.  Virtually all of the divine numerations directly related to the Sun of Righteousness – Messiah Revealed (“27”), His Ministry (“30”), His crucifixion for redemption (“33”) and His Coming in Glory unto the “1335th Day” (“45”) – all have been severely relegated to the periphery of the Sacred Geometric Community – including the divine intention of the Lamb’s Wife, the Woman, the Bride of Messiah – the New Jerusalem’s real purpose as disclosed in her most outstanding, descriptive dimension in her 18,000-mile, 12-edged perimeter (i.e., the “18”); the Wall of the New Jerusalem as seen in the “144” and the incredibly, unrelenting imperative of measurement found in the 25.20” or 2.1’ Sacred Cubit.

 

In addition to these occlusions, we have the most egregious oversight, the Woman, “clothed with the Sun…and the Moon beneath her feet…with the 12 Stars as a garland over her head” of Revelation 12.  She is wholly detached from the astronomical profundities within the Sacred Geometry Community – except for an aside mention by some having “something to do” with the planets and the like.  She is occluded, nigh enduring a total eclipse wherein the lunar qualities of 1080 (the Moon’s radius) overwhelms her and scarce mention is given to the Sun’s radiance upon her which in turn provides the Moon the Sun’s glory. 

 

All this, and of course, the pagan Zodiac declaring soulish personalities and destinies of humans who have turned the “truth of God” into a lie wherein the creature is worshiped more than the Creator Who alone is blessed forever – whereas, the garland over the Woman with 12 Stars bears witness that the Mazzaroth is but the history of the Commonwealth of Israel – both Testaments bearing witness wherein each of the 2,160 year time frames as in 12 x 2,160 = 25,920 years with 1° of this “Great Precessional’s” 360°

termanologytime_machine_hood_porar

terio

terje isungset hibernation

teri ek jhalakchhoti bahu

terez montcalm voodoo 2007

termanology

terisa griffin soulzophrenic dance 2011

equal to 72 years bearing the “Name of God” (“72”) and of the Triune God (i.e., 3° = “216” years).  Likewise, this 25,920 = 2 + 5 + 9 + 2 = “18” bearing the New Jerusalem Standard of Measurement and the “7 Epochal Time Frames from Abraham to Christ” are equal to 7 x 2160 = 15,120 or 1512 which, in Greek Gematria is equal to Apocalypsis and is two base edges of the Great Pyramid of Giza at 756’ x 2 = 1,512’…and the “5 Epochal Time Frames from Christ to the Apocalypse” are equal to 5 x 2160 = 10,800 or the very mark of the New Jerusalem’s “18” as in 10,8.

Continue

 

THE GOOD NEWS

…by Doug Krieger

The Lord of the Harvest has commissioned us that he would “send forth” laborers into His harvest field – for that field is “ripe unto harvest!”  These little, but relevant, gospel tracts/broadsides are designed for the Church to distribute to anyone and anywhere – I only wish they could be translated into other languages and “personalized” – for in all areas of life believers have a testimony of the Grace of God as found in the Redeemer.  This is not optional – all of us are “sent forth” to preach the gospel to everyone!

So – we’ve taken tragedy, addiction and champions in PDF format to be placed on a “flash drive” or directly taken to the printer – “blank address box” is found at the end – you place your own info. there or use the Tribnet web site address – and distribute where you may!  God bless – Lord willing, we’ll have more – no author is found on it – why?  Because we felt it would honor the Lord if you could make it personal – Jesus is real – He alone is worthy – He’ll speak the message and draw all men to Himself if He is lifted up!  Just click on the blank or Tribnet link and what you see is what you’ll get …

Bro. Doug.

Continue

 

scroll


Beauty and the Beast

…the Beast State is Turning on the Church

2-11-12

By Dene McGriff

Today we are witnessing the acquiescence of the church as society and the state impinge upon her. We have two examples. One is national, showing the gradual caving of the church to the modern age as it tries to make herself more accommodating to the State and now experiencing the State’s uncompromising attack on the church. The other has to do with supporting an evangelist who is going to be doing a “season of service” here in Sacramento, California, as an evangelistic outreach – here, the Church attempts to make herself more attractive to the world, less offensive, more in “tune with today’s culture.”

Continue...

tereza brettschweiderova

tereza_editionzip

tereza_brettschweideroeurotrip_1280704avi

teriheeparchhayianshankarmahadevan128kbpssongspk

teri meri bodyguard full song 2011 hd by shreya

teri meri bodyguard video song ft salman khan

teri ada ready hd 2011 720p apnesongscommkv

scroll