SUN OF RIGHTEOUSNESS (3)

108,864 – 954 – 792 – 756 – 216 – 144 – 114,048

Section IV, Part 10 – The Wonderful Numbers of Sacred Canon

agemix064part

agencia ele repaso 1 tarjetas bc 177 pdf

age44

hanoi rocks all those wasted years

agephonemobilev285rar

age of empires iii update 106 keygen by deviance

agemix

agenda2011pdf

by Doug Krieger

 

 
 
 

New Gideon's Chronicle's Post

January 1
Gideon's
Chronicles
converted to a Flip-Book

Day 32 - Latest entry

TribNet Partners

age of empires iii frenchwarchiepsasiandynastiescrackkeys

agip celtis 933

ageenipath

computer networks tenan baum

age of empires iii platinum edition

agelopulos_320kbpsrar

ageods american civil serial number

aged indian aunty mms scandal megauploadtorrent

ageenipath_full_hdzip

agefi bioalps 2009 pdf

diamondrushparapctaringaserialrar

age_technologies_styledraper_v112

agfa adc solo installing

aggiungi un posto a tavola

aghani hazina 2011torrent

agemix 077

Some of our recent articles...

agi secrets of precision long range shooting for hunting or tactical

agilent ads 2010

agi hamil

agilent

agidae pdf

agivee wordpress theme

agidae tabella 2010 2012 pdf

Sun of Righteousness (3)
Section IV, Part 10 – The Wonderful Numbers of Sacred Canon

The Good News

Sun of Righteousness (2)
Section IV, Part 9 – The Wonderful Numbers of Sacred Canon

aggelioforos pdf

agilent ads 2011

agi graphic design dal 1950 a oggi

age_of_empires_3_the_warchiefsrar

agi32 gratis megaupload hotfile freetorrent

age43

agemix064

Beauty and the Beast
…the Beast State is
Turning on the Church

 

Sun of Righteousness (1)
Section IV, Part 8 – The Wonderful Numbers of Sacred Canon

Israel's Alters

Altars – Ancient Egypt to the Apocalypse
Part IV, Section 4 – The Wonderful Numbers of Sacred Canon

None Dare Call it Conspiracy - Rethinking our Lives

 

   

agfa jeti 3348 uv jetspeed rtr pdf

age_of_empires_3part1rar

ageods american civil war keygen

graphic desiign

age42

aggregate testing pdf

ageia_physx_game_installer_264

aggressive_inline_garciazpart14rar

This three-fold sequence on The Sun of Righteousness is a frontal assault upon the metrological indiscretions of the Sacred Geometry Community which, unfortunately for whatever reason – be it purposeful or through darkened neglect – have marginalized, even obfuscated, the Sun of Righteousness.  Virtually all of the divine numerations directly related to the Sun of Righteousness – Messiah Revealed (“27”), His Ministry (“30”), His crucifixion for redemption (“33”) and His Coming in Glory unto the “1335th Day” (“45”) – all have been severely relegated to the periphery of the Sacred Geometric Community – including the divine intention of the Lamb’s Wife, the Woman, the Bride of Messiah – the New Jerusalem’s real purpose as disclosed in her most outstanding, descriptive dimension in her 18,000-mile, 12-edged perimeter (i.e., the “18”); the Wall of the New Jerusalem as seen in the “144” and the incredibly, unrelenting imperative of measurement found in the 25.20” or 2.1’ Sacred Cubit.

 

In addition to these occlusions, we have the most egregious oversight, the Woman, “clothed with the Sun…and the Moon beneath her feet…with the 12 Stars as a garland over her head” of Revelation 12.  She is wholly detached from the astronomical profundities within the Sacred Geometry Community – except for an aside mention by some having “something to do” with the planets and the like.  She is occluded, nigh enduring a total eclipse wherein the lunar qualities of 1080 (the Moon’s radius) overwhelms her and scarce mention is given to the Sun’s radiance upon her which in turn provides the Moon the Sun’s glory. 

 

All this, and of course, the pagan Zodiac declaring soulish personalities and destinies of humans who have turned the “truth of God” into a lie wherein the creature is worshiped more than the Creator Who alone is blessed forever – whereas, the garland over the Woman with 12 Stars bears witness that the Mazzaroth is but the history of the Commonwealth of Israel – both Testaments bearing witness wherein each of the 2,160 year time frames as in 12 x 2,160 = 25,920 years with 1

age of empires 1 full

age of empires 3 games

age of mythology

agip formula prestige sae 5w30

aggressive_aim_cfg_aimbotrar

age of empires 2 the conquerors v10c crack by dbc

agenda escolar

° of this “Great Precessional’s” 360

age of empires iii mac osxtorrent

agi

aggiornamento

agent lily

age_of_empire_3_rar

aggiornamenti mappe tom tom 2012 gratis

agip oso iso 100 2305 pdf

°

agi32 tutorial

age_de_glace2avi

agenzia delle dogane roma istanza rilascio licenza per vendita pro dotti alcolici modulistica

agentes_ambientaispdf

ageofempiresiitheconquerorsrar

aggressive periodontitis ppt 2011

botbucherongratuitdofusfinaldjvu

agelopulos

equal to 72 years bearing the “Name of God” (“72”) and of the Triune God (i.e., 3

agenda book 201112 finalpdfetter1

agi stk 9

agente de higienizao de sade

agencia ele repaso 1 tarjetas bc_177pdf

age_of_empires_2part1rar

°
= “216” years).  Likewise, this 25,920 = 2 + 5 + 9 + 2 = “18” bearing the New Jerusalem Standard of Measurement and the “7 Epochal Time Frames from Abraham to Christ” are equal to 7 x 2160 = 15,120 or 1512 which, in Greek Gematria is equal to Apocalypsis and is two base edges of the Great Pyramid of Giza at 756’ x 2 = 1,512’…and the “5 Epochal Time Frames from Christ to the Apocalypse” are equal to 5 x 2160 = 10,800 or the very mark of the New Jerusalem’s “18” as in 10,8.

Continue

 

THE GOOD NEWS

…by Doug Krieger

The Lord of the Harvest has commissioned us that he would “send forth” laborers into His harvest field – for that field is “ripe unto harvest!”  These little, but relevant, gospel tracts/broadsides are designed for the Church to distribute to anyone and anywhere – I only wish they could be translated into other languages and “personalized” – for in all areas of life believers have a testimony of the Grace of God as found in the Redeemer.  This is not optional – all of us are “sent forth” to preach the gospel to everyone!

So – we’ve taken tragedy, addiction and champions in PDF format to be placed on a “flash drive” or directly taken to the printer – “blank address box” is found at the end – you place your own info. there or use the Tribnet web site address – and distribute where you may!  God bless – Lord willing, we’ll have more – no author is found on it – why?  Because we felt it would honor the Lord if you could make it personal – Jesus is real – He alone is worthy – He’ll speak the message and draw all men to Himself if He is lifted up!  Just click on the blank or Tribnet link and what you see is what you’ll get …

Bro. Doug.

Continue

 

scroll


Beauty and the Beast

…the Beast State is Turning on the Church

2-11-12

By Dene McGriff

Today we are witnessing the acquiescence of the church as society and the state impinge upon her. We have two examples. One is national, showing the gradual caving of the church to the modern age as it tries to make herself more accommodating to the State and now experiencing the State’s uncompromising attack on the church. The other has to do with supporting an evangelist who is going to be doing a “season of service” here in Sacramento, California, as an evangelistic outreach – here, the Church attempts to make herself more attractive to the world, less offensive, more in “tune with today’s culture.”

Continue...

scroll